PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G16730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 155aa    MW: 17498.8 Da    PI: 9.5546
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G16730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-1859105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde+l +av  + g++Wk+Ia+ +   Rt+ qc +rwqk+l
  OMERI05G16730.1  59 KGGWTPEEDEKLRKAVDIYNGKNWKKIAESFS-DRTEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding55.21.7e-17111154145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g+WT+eEd+ +++ vk++G++ W+ Iar ++ gR +kqc++r++
  OMERI05G16730.1 111 KGPWTQEEDDVIINMVKKHGPKKWSVIARSLN-GRIGKQCRERYL 154
                      79******************************.**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.29454105IPR017930Myb domain
SuperFamilySSF466891.08E-1556107IPR009057Homeodomain-like
SMARTSM007175.8E-1558107IPR001005SANT/Myb domain
PfamPF002493.8E-1659105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2361112IPR009057Homeodomain-like
CDDcd001671.82E-1362105No hitNo description
SuperFamilySSF466891.38E-2390154IPR009057Homeodomain-like
PROSITE profilePS5129423.29106155IPR017930Myb domain
SMARTSM007171.1E-8110154IPR001005SANT/Myb domain
PfamPF002491.2E-15111154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-21113153IPR009057Homeodomain-like
CDDcd001675.20E-13113153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGAMPAVKVE EEEEEERNPV ASSPSVSEGS AHAAALASPT AADSIFGRRR KSGPVRRAKG  60
GWTPEEDEKL RKAVDIYNGK NWKKIAESFS DRTEVQCLHR WQKVLDPELI KGPWTQEEDD  120
VIINMVKKHG PKKWSVIARS LNGRIGKQCR ERYLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-3811531142MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-3811531142MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1067561e-127AK106756.1 Oryza sativa Japonica Group cDNA clone:002-115-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637435.13e-89PREDICTED: uncharacterized protein LOC4339005
SwissprotQ9S7G74e-48MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0E0DSG71e-111A0A0E0DSG7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA017917-PA1e-101(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.23e-56myb domain protein 3r-5